filler

• Substantivo que designa uma substância usada para preencher rachaduras ou buracos, uma moeda de baixo valor na Hungria ou conteúdo usado para preencher espaço em publicações ou outros contextos.

A noun referring to a substance used for filling cracks or holes, a token of small monetary value in Hungary, or content used to occupy space in publications or other contexts.

1. Material for filling gapsB1formal

   A substance used to fill cracks, holes, or imperfections in a surface before painting or finishing.

   Massa corrida

   • Apply wood filler to the nail holes before sanding.
   • The painter used a plaster filler to repair the wall cracks.
   • A good filler will make the surface smooth and even.

   Sinônimoscompoundfillputtyspacklestopping

2. Hungarian monetary unitB2formal

   A subunit of the Hungarian forint, where 100 fillér equal 1 forint.

   Unidade monetária húngara

   • The price was listed as 50 fillér in the old catalog.
   • Hungary used fillér coins before the currency was reformed.
   • One forint was once divided into 100 fillér.

3. Journalistic placeholderB2formal

   A short article or piece of content used to fill space in a newspaper or magazine layout.

   Enchimento

   • The editor added a filler article about local events.
   • This page has a filler piece on gardening tips.
   • Fillers are often used to balance the layout of a magazine.

   Sinônimosfill-inmakeweightpaddingstopgap

4. General additionB1informal

   Something added to complete a whole or to occupy space or time.

   Preenchimento

   • The extra songs on the album are just filler.
   • He used filler words like 'um' and 'like' during his speech.
   • The box contained filler material to protect the fragile items.

   Sinônimosfillinginsertmakeweightpaddingstuffingsupplement

   Antônimosessentialnecessity

5. Cigar coreC1formal

   The blend of tobacco leaves used to form the inner core of a cigar.

   Miolo do charuto

   • The filler tobacco determines the cigar's flavor and strength.
   • A premium cigar uses long-filler leaves for a consistent burn.
   • The roller carefully selected the filler for each cigar.