forward

• Dirigido o que se mueve hacia adelante; también se usa para describir a una persona que actúa con atrevimiento o excesiva familiaridad.

Directed or moving ahead; also used to describe someone who is bold or overly familiar in manner.

1. DirectionalA2formal

   Directed or moving toward the front or a point ahead.

   hacia adelante

   • The forward movement of the train was smooth.
   • She took a forward step to greet him.
   • The forward position on the team requires speed.

   Sinónimosaheadfrontalfrontwardonward

   Antónimosbackbackwardrearward

2. Bold or presumptuousB2formal

   Showing a lack of modesty or restraint; overly confident or assertive.

   Atrevido o descarado

   • His forward comment made everyone uncomfortable.
   • She was too forward in asking for a promotion on her first day.
   • The child's forward behavior surprised the guests.

   Sinónimosaudaciousboldbrashbrazencheekyfamiliarimpertinentimpudentpresumptuouspushysaucy

   Antónimosbashfuldiffidentmodestreservedretiringshytimid

3. Progressive or advancedB1formal

   Relating to or promoting progress or development.

   Progresista o avanzado

   • The company has a forward approach to technology.
   • He has forward ideas about education reform.
   • This is a forward step in medical research.

   Sinónimosadvancedavant-gardeenterprisingforward-lookinginnovativeliberalmodernpioneeringprogressive

   Antónimosbackwardconservativereactionaryregressiveretrograde

• Adverbio que indica movimiento o dirección hacia adelante, hacia el frente o hacia el futuro, tanto en sentido físico como figurado, incluyendo la idea de progreso o avance.

An adverb meaning 'toward the front,' 'in the direction one is facing,' or 'ahead in time or progress.' It is used to indicate movement, direction, or advancement in both literal and figurative senses.

1. Direction of movementA1formal

   Toward the front or in the direction one is facing.

   hacia adelante

   • Please step forward when your name is called.
   • The car moved forward slowly.
   • He leaned forward to hear better.

   Sinónimosaheadforthfrontwardfrontwardsonwardonwards

   Antónimosbackwardbackwards

2. Progress or advancementA2formal

   Toward a future time or a more advanced state.

   hacia adelante (progreso)

   • We need to move forward with the project.
   • The technology has come a long way forward.
   • She looked forward to the weekend.

   Sinónimosaheadforthfurtheronwardonwards

   Antónimosbackbackward

3. Time referenceB1formal

   Toward a later time or date.

   hacia adelante en el tiempo

   • The meeting was moved forward to Monday.
   • From this point forward, we will follow the new rules.
   • The deadline has been pushed forward by two days.

   Sinónimosaheadforthfurtheronwardonwards

   Antónimosbackward

• Sustantivo que designa a un jugador de la línea de ataque en deportes como el fútbol, el hockey o el baloncesto, cuya función principal es atacar y marcar goles. También puede referirse a cualquier elemento o persona que va delante o a la vanguardia.

A noun referring to a player in a forward position in certain sports, such as football, hockey, or basketball, whose primary role is to attack and score goals.

incontable

1. Attacking playerB1formalsport

   A player in sports like soccer, hockey, or basketball whose primary role is to attack and score goals.

   Delantero

   • The forward scored the winning goal in the final minute.
   • The team's forwards are known for their speed and agility.
   • He plays as a forward for the national team.

   Sinónimosattackerstriker

   Antónimosbackdefendergoalkeeper

• Verbo que se usa para indicar la acción de enviar algo más adelante, especialmente a un nuevo destinatario o receptor; también puede referirse a promover o hacer avanzar algo.

A verb used to indicate the act of sending something onward, especially to a new destination or recipient.

1. Send onwardB1formal

   To send something (like a letter, email, or package) to a new destination or recipient.

   Reenviar

   • Please forward this email to the sales department.
   • The post office will forward my mail to my new address.
   • She forwarded the documents to her lawyer.

   Sinónimosdispatchpass onredirectrelayremitsendshiptransmit

2. Promote or advanceB2formal

   To help something progress or develop; to advance a cause or plan.

   promover o impulsar

   • The committee worked to forward the goals of the organization.
   • He used his influence to forward the peace negotiations.
   • The new policy will forward economic growth.

   Sinónimosaccelerateadvanceaidassistbackboostchampionencourageexpeditefacilitatefosterfurtherhastenhelppromotepropelsupport

   Antónimosblockdiscouragehamperimpedeobstructopposeretardstiflethwart