gummed

• صفة تعني 'مُغَطَّى بالصَّمْغ' أو 'لَزِج'; تُستعمل الآن بشكل نادر إلا في السياقات التقنية المتخصصة.

An obsolete adjective meaning 'covered with gum' or 'sticky'; now rarely used except in specific technical contexts.

1. Coated with adhesiveB2formal

   Having a sticky substance applied, typically for sealing or sticking.

   مُغَرَّى

   • The envelope had a gummed flap that needed to be moistened.
   • He used gummed labels for the packages.
   • The gummed tape was difficult to peel off.

   المرادفاتadhesiveglueygummypastedself-sealingstickytacky

   الأضدادdrynonadhesiveungummed

2. Stuck or cloggedB2informal

   Blocked or made sticky, often due to a viscous substance.

   ملتصق أو مسدود

   • The machine's gears were gummed up with old oil.
   • His eyes were gummed shut after a long sleep.
   • The drain was gummed with soap residue.

   المرادفاتadhesiveblockedcloggedglutinousgummystickytackyviscid

• فعل يعني مضغ الطعام أو لصق الأشياء باستخدام العلكة أو مادة لاصقة، أو دهن شيء بمادة صمغية.

A verb meaning to chew or stick with gum, or to apply adhesive gum to something.

1. B1informal

   To chew or masticate something, especially with the gums.

   المضغ باللثة

   • The baby gummed the teething ring.
   • He gummed his food slowly because of his sore teeth.
   • She gummed the candy until it softened.

   المرادفاتchewmasticatemouthmumble

2. Stick or clogB2informal

   To cause something to become sticky or clogged, often with a sticky substance.

   ألصق أو سدّ

   • The syrup gummed up the machine's gears.
   • The glue gummed the pages of the book together.
   • The drain was gummed up with hair and soap.

   المرادفاتblockchokecloggluejamobstructpasteplugstickstop

الصيغ المركّبةgum up