gummed

• Adjetivo que significa 'coberto de goma' ou 'pegajoso'; atualmente é pouco usado, exceto em contextos técnicos.

An obsolete adjective meaning 'covered with gum' or 'sticky'; now rarely used except in specific technical contexts.

1. Coated with adhesiveB2formal

   Having a sticky substance applied, typically for sealing or sticking.

   Gomado

   • The envelope had a gummed flap that needed to be moistened.
   • He used gummed labels for the packages.
   • The gummed tape was difficult to peel off.

   Sinônimosadhesiveglueygummypastedself-sealingstickytacky

   Antônimosdrynonadhesiveungummed

2. Stuck or cloggedB2informal

   Blocked or made sticky, often due to a viscous substance.

   Grudento ou entupido

   • The machine's gears were gummed up with old oil.
   • His eyes were gummed shut after a long sleep.
   • The drain was gummed with soap residue.

   Sinônimosadhesiveblockedcloggedglutinousgummystickytackyviscid

• Verbo que significa mastigar com as gengivas ou sem dentes, grudar ou colar algo com goma ou substância adesiva, ou aplicar uma substância pegajosa em algo.

A verb meaning to chew or stick with gum, or to apply adhesive gum to something.

1. B1informal

   To chew or masticate something, especially with the gums.

   Mastigar com as gengivas

   • The baby gummed the teething ring.
   • He gummed his food slowly because of his sore teeth.
   • She gummed the candy until it softened.

   Sinônimoschewmasticatemouthmumble

2. Stick or clogB2informal

   To cause something to become sticky or clogged, often with a sticky substance.

   Entupir

   • The syrup gummed up the machine's gears.
   • The glue gummed the pages of the book together.
   • The drain was gummed up with hair and soap.

   Sinônimosblockchokecloggluejamobstructpasteplugstickstop

Variantes phrasalgum up