gummed

• Adjectif désignant ce qui est enduit de gomme ou devenu collant, notamment par évaporation d'un mucilage ; il peut aussi qualifier un papier ou un timbre dont le dos est gommé.

An obsolete adjective meaning 'covered with gum' or 'sticky'; now rarely used except in specific technical contexts.

1. Coated with adhesiveB2formal

   Having a sticky substance applied, typically for sealing or sticking.

   endu de gomme adhésive

   • The envelope had a gummed flap that needed to be moistened.
   • He used gummed labels for the packages.
   • The gummed tape was difficult to peel off.

   Synonymesadhesiveglueygummypastedself-sealingstickytacky

   Antonymesdrynonadhesiveungummed

2. Stuck or cloggedB2informal

   Blocked or made sticky, often due to a viscous substance.

   englué, collé ou obstrué

   • The machine's gears were gummed up with old oil.
   • His eyes were gummed shut after a long sleep.
   • The drain was gummed with soap residue.

   Synonymesadhesiveblockedcloggedglutinousgummystickytackyviscid

• Verbe signifiant mâcher ou coller avec de la gomme, ou enduire quelque chose d'une substance collante.

A verb meaning to chew or stick with gum, or to apply adhesive gum to something.

1. B1informal

   To chew or masticate something, especially with the gums.

   Mâcher avec les gencives

   • The baby gummed the teething ring.
   • He gummed his food slowly because of his sore teeth.
   • She gummed the candy until it softened.

   Synonymeschewmasticatemouthmumble

2. Stick or clogB2informal

   To cause something to become sticky or clogged, often with a sticky substance.

   encrasser, coller

   • The syrup gummed up the machine's gears.
   • The glue gummed the pages of the book together.
   • The drain was gummed up with hair and soap.

   Synonymesblockchokecloggluejamobstructpasteplugstickstop

Variantes phrasalgum up