gummed

• Adjetivo que significa 'cubierto de goma o resina' o 'pegajoso'; también puede referirse a algo tratado con adhesivo, como papel o sellos. En desuso en gran medida, salvo en contextos técnicos específicos.

An obsolete adjective meaning 'covered with gum' or 'sticky'; now rarely used except in specific technical contexts.

1. Coated with adhesiveB2formal

   Having a sticky substance applied, typically for sealing or sticking.

   engomado

   • The envelope had a gummed flap that needed to be moistened.
   • He used gummed labels for the packages.
   • The gummed tape was difficult to peel off.

   Sinónimosadhesiveglueygummypastedself-sealingstickytacky

   Antónimosdrynonadhesiveungummed

2. Stuck or cloggedB2informal

   Blocked or made sticky, often due to a viscous substance.

   Pegado u obstruido

   • The machine's gears were gummed up with old oil.
   • His eyes were gummed shut after a long sleep.
   • The drain was gummed with soap residue.

   Sinónimosadhesiveblockedcloggedglutinousgummystickytackyviscid

• Verbo que significa masticar o pegar con goma, o aplicar una sustancia adhesiva sobre algo.

A verb meaning to chew or stick with gum, or to apply adhesive gum to something.

1. B1informal

   To chew or masticate something, especially with the gums.

   Masticar con las encías

   • The baby gummed the teething ring.
   • He gummed his food slowly because of his sore teeth.
   • She gummed the candy until it softened.

   Sinónimoschewmasticatemouthmumble

2. Stick or clogB2informal

   To cause something to become sticky or clogged, often with a sticky substance.

   obstruir con sustancia pegajosa

   • The syrup gummed up the machine's gears.
   • The glue gummed the pages of the book together.
   • The drain was gummed up with hair and soap.

   Sinónimosblockchokecloggluejamobstructpasteplugstickstop

Variantes phrasalgum up